PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5843_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 614aa    MW: 67702 Da    PI: 8.5443
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5843_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094024391954
                                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                          Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  cra_locus_5843_iso_2_len_2444_ver_3 402 FEHflHPYPTDTDKIMLAKQTGLSRNQVSNWFINARVR 439
                                          554459******************************88 PP

2BELL99.52.7e-32264333372
                                 BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                           e++kkk++L+s+l+eV+krYkqy++q+q+v++sFeavag+ +a+p+++lAlka+S+hF+ Lk+ i++q+
  cra_locus_5843_iso_2_len_2444_ver_3 264 SENRKKKSRLMSMLHEVCKRYKQYYQQMQAVVASFEAVAGVRNAAPFANLALKAMSKHFKYLKNTITDQL 333
                                          689****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.4E-48196331IPR006563POX domain
PfamPF075262.9E-36201330IPR006563POX domain
PROSITE profilePS5007112.098380443IPR001356Homeobox domain
CDDcd000862.27E-12383444No hitNo description
SMARTSM003893.1E-10383447IPR001356Homeobox domain
SuperFamilySSF466894.71E-17385450IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-28386447IPR009057Homeodomain-like
PfamPF059206.6E-19400439IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDKLR ILSGHQNQQP SAAAGVGQGL LPLIYDIPST ACGVKVENAN  60
LMAQIMAASS SSSNNHLYID PPQLNPSSIE GFLNYNNTPH PPQGGLRFLH DQSFPLSVVT  120
HESNNNNNNS NRSGSGQALS LSLSSNNNHP TLPPQLDLNL QRYDINNSSI FTTPSKVITT  180
GDVSGSRNSV PLGPFTGYAS VLKGSRFLKP AQLLLEELCE VGRGISSFEK IEAADHYLFM  240
DSPLESLCGT GIEDDPQTCT GNGSENRKKK SRLMSMLHEV CKRYKQYYQQ MQAVVASFEA  300
VAGVRNAAPF ANLALKAMSK HFKYLKNTIT DQLQFITEPR STQIAREKDS TTLCFDNPLM  360
GIQNERQLQN VGLVHDHHHQ PVWRPQRGLP ERAVTVLRAW LFEHFLHPYP TDTDKIMLAK  420
QTGLSRNQVS NWFINARVRL WKPMVEEIHM LETRQAQKAS HKEDKNADQR QNNAMASTNR  480
VSCEKKITSS QKVEDFPSKR TRSDLTAIQT RNEGDMNLLP YDNSSRHPCL NVGHVSTGAG  540
AGAGAGGTGG VSLTLGLHQN NNGIGLGDTF PINAARRFGL DSNNDGYVIG GIDARNRQFG  600
REIIGGQLLH DFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-16389446158Homeobox protein Meis1
4xrs_B7e-16389446158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010654234.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-114BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
TrEMBLA5AHA10.0A5AHA1_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237